DPCstruct | MC61836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 245 ± 29 aa |
| Standard deviation of domain lengths | 29.32 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0745- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5MT96 | 1-285 | MGLQDAGVPNHGQEHTETVEEFKATLYEMQQIRRKIVLAVLSKEAPSPDFIPLLEASLERLKDRNTSADLQRNMRTASNEPFAVNVS… |
| A0A0K0EQ26 | 13-280 | NDEGTIRGGQTVEEFKAMMYGVQCHRRKIVEDLIAGKILDNDSFINIKQSLEFLNNNMKDKNEGFMAEMILSREGSNEKTFLINLKD… |
| A0A183F7S4 | 77-266 | None |
| A0A0R3S1V6 | 563-813 | None |
| A0A811LP93 | 4-287 | None |
| A0A183DRV7 | 47-303 | None |
| A0A077Z746 | 760-986 | None |
| A0A183J4X7 | 676-915 | None |
| A0A7S1HUL6 | 238-445 | None |
| A0A0R3RAT1 | 1-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.