DPCstruct | MC61829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 85 ± 14 aa |
| Standard deviation of domain lengths | 14.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 98.78 |
| Assigned Pfam label(s) | PF02953- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443SMK6 | 5-79 | ATDQIKQFKDFILNYNRLSEQCFMDCIYDFTTRNLSSKEDDCSNKCVDKFLKMNQRISQRFQEYQMIASEKLQQQ |
| E9GYJ3 | 12-87 | EAEQIKSFRDFLFSYNKLSELCFVDCVWDFTSRTIKDQENSCAVNCAEKFLKANQRISQRFQEFQVLSNENALAMA |
| A0A421JBV8 | 830-898 | None |
| A0A1Q8RAV8 | 171-253 | None |
| A0A2H3SC66 | 38-122 | None |
| A0A7J6RDV9 | 9-94 | None |
| A0A2T7PLT9 | 1-97 | None |
| A0A835NTN4 | 6-94 | None |
| A0A7J6L6H7 | 369-456 | None |
| A0A6J3EL31 | 20-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.