DPCstruct | MC61821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 73.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6LLH1 | 167-273 | AKAVAEYQYPWREKLVKYKDELAKGVWGYWDLGAWKPLSISARRRARLRKEVLLTGEDWPYDPERKEMKTRRKGHKCDRISAEKREN… |
| A0A388KNE4 | 6-102 | EAQLAAGLKRLAAKVKPTWFNGKFVGTDMSAKNIARVRRQVLLVGEEWPYDKPRKEMKTRVKGHKVDRIAQAKREKTKELMEQMPQL… |
| A0A3L6RBA2 | 9-115 | None |
| A0A452XP74 | 8-112 | None |
| A0A4D9C323 | 28-139 | None |
| A0A453REN1 | 4-93 | None |
| A0A453RE17 | 2-94 | None |
| A0A2R6RMJ2 | 69-182 | None |
| A0A5J5B497 | 513-611 | None |
| A0A7J9E2V4 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.