DPCstruct | MC61820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 58.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6LH54 | 1-81 | MLQEIVGKPRGQQLKVIYPKCNKQEDSWECGYYVMSWIRTIIRAAVKDEWIERFKNPSPLPDDIIHTLRQEWAAYLLERWS |
| A0A0S3TBB9 | 1-65 | MQIITPNCRRQLGSYECGYYVMKHMHTIICTNIIESWNKIFNDSSPMEAADMEDIRRNWASFILS |
| A0A4D6MU08 | 83-152 | None |
| A0A0L9T7M4 | 1-69 | None |
| A0A0L9T6V7 | 229-295 | None |
| A0A0L9T5L7 | 97-163 | None |
| A0A0L9T412 | 247-310 | None |
| A0A4D6M092 | 82-146 | None |
| A0A0L9U4D4 | 357-420 | None |
| A0A0L9UYF4 | 31-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.