DPCstruct | MC61816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 11 aa |
| Standard deviation of domain lengths | 10.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF12923- CL0221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0RQS5 | 2-119 | EMCNSAMEAFEHEEVETERRAKMAAEQPDDDGFITVAQGAPSFGTTNDLEEDKHARRRAGKRNRKRKAGGSGADELQDFYRFQLKET… |
| A0A3L7IAK3 | 2-133 | FPSPSEWISEYQDSVLDPEALRVEVDTFMEAYDKKIAEEETKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLEREKRKRAR… |
| A0A0N5CLC9 | 198-328 | None |
| A0A0E9NIC1 | 236-365 | None |
| Q6CC12 | 121-254 | None |
| A0A7R9ZRJ7 | 7-149 | None |
| A0A7S2W011 | 73-215 | None |
| B7GAM4 | 201-342 | None |
| A0A7S4ABL7 | 285-431 | None |
| A0A1E3QKK4 | 162-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.