DPCstruct | MC61811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 152 ± 30 aa |
| Standard deviation of domain lengths | 29.77 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0RBA4 | 37-153 | SGLWYPDWAGQDGTCKNDGNEPEYMASNPVAWMKPSKEACCEANFGWMLNGCLGSSAIRIAIDKWFIDWDDYKCKRDCAVGTGPSCG… |
| B8CCS3 | 9-191 | LLSITASTTTAQWGPDWLNSTGTCLDEGLPEYMESNNLLKASLEECCETYYTYGAAECIIDGGGNPPTGSGEWYVDYEGSRCVTDCY… |
| B5YMA1 | 80-224 | None |
| K0R8D2 | 941-1067 | None |
| K0RJZ0 | 128-247 | None |
| K0RN98 | 341-493 | None |
| B5YMI3 | 486-694 | None |
| B8C3U8 | 422-556 | None |
| B8C4U2 | 130-265 | None |
| B8C7P1 | 410-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.