DPCstruct | MC61805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 172 ± 27 aa |
| Standard deviation of domain lengths | 27.45 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 76.19 |
| Assigned Pfam label(s) | CL0023- CL0306- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833KM20 | 1-138 | IIFAILKRHAMNGEEIFGDGVLEILSDGFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQIN… |
| A0A402AYD4 | 63-196 | MRPPAAVSDQELAVPGAGILDIVEDGYGFLRSERYLSGPQDIYVSHSQIRRFGLRQGDFVAGQVRPPKEREQYGGLLRVEQVNGRGA… |
| A0A1M3LG61 | 131-289 | None |
| A0A7V1RCK9 | 9-148 | None |
| A0A7V9HAH0 | 68-220 | None |
| A0A0K2RR81 | 167-385 | None |
| A0A1H6KMR0 | 194-362 | None |
| X1AN15 | 1-193 | None |
| A0A0G1WGI1 | 1-165 | None |
| A0A2E7CJP9 | 35-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.