DPCstruct | MC61802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 555 |
|---|---|
| Mean domain length (aa) | 252 ± 62 aa |
| Standard deviation of domain lengths | 61.65 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.70 |
| Pfam Score | 84.73 |
| Assigned Pfam label(s) | PF01300- CL0036- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5EKI3 | 3-219 | YLYETHLHTIEGSACSDTPGKEYIAHMKKIGYSGIIVTDHFYNGNTAVPRTLPWKEWVENYCLGYEHAYEAAKDKDFDVFFGIEINF… |
| A0A285BFP1 | 8-259 | IKGDFHLHTLYSDNMDKMDVSDYDKLAKKYGLDVLCITDHHHNLTQNTWEELSLKIKNHVGLPLIMQGYEITFAKGHIVLLNKSIFD… |
| A0A511TDE9 | 48-418 | None |
| A0A7X2ZVA5 | 1-242 | None |
| A0A2M6YD10 | 320-519 | None |
| A0A285NEH6 | 35-339 | None |
| A0A7C4R2T2 | 47-302 | None |
| A0A3B0B0L2 | 1-233 | None |
| A0A0S7Z163 | 34-380 | None |
| A0A1Y2HVK4 | 262-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.