DPCstruct | MC6180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 150 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1IDD7 | 4-167 | SSPPATNSNVGTIPTTTSTHQNEVKHMPPTQNTGRDEGDYRSHHDFYKEPLFTSIFGTSTTPSVLTQAQLQDFFIKVGGVPQHDLHK… |
| A0A3G7ULS2 | 42-180 | GINKPEQDVRRKPDFSTGRPPGDKRTAEEIIKDNPILANLKRVKDANFSLAFELVGDWTEDNKDPNARADAAFNAARVLNYIDTSLS… |
| A0A0Q0JWE4 | 4-163 | None |
| F8CGG6 | 214-372 | None |
| A0A2S9JP24 | 1-152 | None |
| A0A7Y1DEA0 | 1-175 | None |
| A0A177G4T9 | 173-344 | None |
| A0A7M1KK11 | 3-136 | None |
| A0A7Y8UXH6 | 2-107 | None |
| A0A656GY06 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.