DPCstruct | MC618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.30 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.57 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0036- CL0546 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HQ17 | 1-78 | MDESYKLSITNSTAILKADQVWGILRGLESFAHLFYDQNTRIRKAEIRDYPRFLHRGVLLDTARHYLSIDVLKANIEL |
| A0A0N4X1I5 | 1-85 | MDESYNLVVDKSKGIATLTANQVWGALRGLETFSQLIYQPVKNRYRIRTVSISDSPRFPHRGVMIDSSRHFLPVGIILENLVRMA |
| A0A817L318 | 28-111 | None |
| A0A2G9UY59 | 80-164 | None |
| A0A820WSG4 | 332-409 | None |
| A0A820W6F3 | 51-132 | None |
| A0A091D9E3 | 10-100 | None |
| A0A504YB32 | 21-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.