DPCstruct | MC61798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9N295 | 1-70 | MSDKENPDSGKMAFDILLMRPFGMIATVLGSAAFVVSLPFSFMGGNIEPAYEKMVEDPAAYTFNRPLGDF |
| A0A1V6AVR4 | 20-89 | PVSAYETSDIDIIADVFFARPGGIAAIAAGSAVFVLALPFSLPTRSAGVVGQRLVLDPVEFTFCRPVGDF |
| A0A558HH66 | 9-91 | None |
| A0A1S9CVY1 | 39-127 | None |
| X0QZN9 | 6-90 | None |
| A0A507WC77 | 8-101 | None |
| A0A1Q2SMX9 | 47-114 | None |
| A0A7C7Y0Z3 | 14-106 | None |
| A0A354TJB6 | 2-97 | None |
| A0A521WXE9 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.