DPCstruct | MC61797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0H7K1 | 4-202 | KTAVDEMFRKVGRNLYIIQQVEMMLKAYLSHSSICGSMSEAGDPQQRQLDRFALQTMGGLATQYLCLIDPGYKYPENNSPDKFSVQF… |
| A0A291HS90 | 14-192 | VHQKIGRNLLLFQKLEYTLKMMVAMSEISGYATNLEENIDLRTAWAMKKTLGQIVGEHVESFNSVDEHGPEPSPMRKEPHLSMRITT… |
| A0A7I8CA44 | 2-192 | None |
| A0A1G0JDH7 | 18-176 | None |
| R9VH37 | 2-198 | None |
| A0A4R2L3K6 | 12-218 | None |
| A0A7X0CF30 | 52-231 | None |
| K9PW61 | 5-262 | None |
| A0A395JTS9 | 4-186 | None |
| A0A849TYA2 | 9-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.