DPCstruct | MC61789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2K8F0 | 16-173 | ENVSRKASYYEQEYHGCCEATLLALLESFNIPLTHLRVATGFAAGIGLRGLTCGALCGGVMAIGLIFGRSYEDYISHDPAGKHYVAL… |
| A0A7K4B8G7 | 5-149 | PVAVSSDLFAQGYNCSQSVFTAFAKENGLDPSMALKIATSYGGGIGRTGNVCGAVSGAILAIGLTHGMDSLQETEKKEKCYALDQEF… |
| A0A418LZS0 | 5-133 | None |
| Q727V1 | 90-248 | None |
| A0A1F4PXY7 | 2-134 | None |
| A0A833H0T5 | 22-160 | None |
| A0A7J9TB54 | 318-467 | None |
| A0A1C3F8K5 | 164-304 | None |
| A0A1F8M4W1 | 4-143 | None |
| A0A1V6CIG3 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.