DPCstruct | MC61787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 20 aa |
| Standard deviation of domain lengths | 19.52 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B6V0F4 | 1-77 | MRTAKQPEKVNYHSKNLITERNIRKKIKDGLFKLRALVPKISKMDITAILTDAIEYIGNLQEEEMNLSNELKKTEEG |
| A0A835VAL4 | 316-391 | TGAGEQKGRKKGLPAKNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLQRINDLHNELESTT |
| A0A7J6H3E7 | 300-410 | None |
| A0A7J6DKE0 | 348-429 | None |
| A0A1R3JWS0 | 329-395 | None |
| A0A6A2X5Z8 | 226-302 | None |
| S8CBZ1 | 9-87 | None |
| A0A3L6RTN1 | 33-145 | None |
| A0A6M4C8K2 | 1-129 | None |
| M5WJT8 | 4-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.