DPCstruct | MC6178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 39.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B3SNY1 | 2-47 | QCKHYYSTWDKYAPRGCRKFDMKSTTMPSILVKQESGNDCQFYEQK |
| A0A1Q3RDP3 | 19-72 | RIDCRKCQHFYVTWDPNAPNGCRKFAFKTRLIPSDVVYQSSGEACKGFLAKGSV |
| A0A2E0N1W6 | 11-73 | None |
| A0A7X9GET6 | 1-53 | None |
| A0A2N6D3I2 | 1-49 | None |
| A0A1W9VPE0 | 5-62 | None |
| A0A0X3T857 | 4-67 | None |
| A0A381ESJ9 | 40-95 | None |
| A0A1C4D4B9 | 61-119 | None |
| A0A2D7C4I3 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.