DPCstruct | MC61770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 211 ± 43 aa |
| Standard deviation of domain lengths | 42.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 69.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 16.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2IC73 | 8-202 | TLPAGFTEFNGDKQQQTVFDCEAIKDDDDKELWLIRVPQEVSDSSLKSMKIKLSKTPGKPVSRLHLDEKDQYTMYRVPEGKSLDSDV… |
| Q75BM8 | 3-187 | SMSNEYVSDSSDSEREVEERFEVPAGFKQCKHLKDFKKPKGSKQELWLMKLPSSVDIGKLKKIPVDFAGDAPASFSVDGKKYVVRED… |
| C1MNA0 | 6-176 | None |
| A0A1B8G4Q5 | 62-253 | None |
| A0A2S4VLY3 | 26-223 | None |
| A0A166CSU4 | 99-354 | None |
| A0A0J6XZW7 | 57-314 | None |
| A0A099P3Z8 | 33-225 | None |
| A0A4V3SJU9 | 33-265 | None |
| A0A1L9TBP4 | 2-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.