DPCstruct | MC61761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 114 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1IXS9 | 1-105 | MSRRRSRVGRMDAAIDHFTPMGYKETQVRSVVNSLLKVYGNDGWPLLEGDCYEVVQQELFKQEEEEEKLQLQEQKQQPVEDVEEEGG… |
| A0A2G9I567 | 1-87 | MPRGRPRKPRLTRMDAAVDAMAKLGFPEEKVRKIVKELLKEYGGNEGWPFIEDNSYTELLEALLRDAEENTQLKTVEDENQLKPQDM |
| A0A6D2JWN4 | 4-127 | None |
| A0A6P5G7B6 | 1-103 | None |
| A0A5N6PAP1 | 1-96 | None |
| A0A0D9XBA7 | 1-149 | None |
| A0A0D9XBB5 | 1-111 | None |
| A0A6V7NEZ3 | 62-177 | None |
| A0A0A8YL49 | 1-115 | None |
| A0A3S3M800 | 60-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.