DPCstruct | MC6176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 126 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3FSA1 | 1-134 | MAEYETRMVLQSFKSRGGLLKPAGPDQYSDAQKDVVGLADKMQSWTSDEVPKEYEYGKSFLPFNLMCELPWPMRLMHEWYLRASELG… |
| A0A270R797 | 25-114 | YTSENPKYRVGKSLLIVPELRTTGQYCVDLHNYYMRNVNKAQEIMVSYEERHFLQLEGSGNIFIVAFCDLFDLFNLDTLDLSLIWCF… |
| A0A3L6PIX8 | 53-142 | None |
| Q2R0C6 | 57-175 | None |
| Q2R4U3 | 261-391 | None |
| Q2R5F5 | 276-408 | None |
| Q2R7P3 | 436-552 | None |
| Q2QWG5 | 94-261 | None |
| Q5H9V6 | 325-432 | None |
| A0A3L6PAC1 | 155-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.