DPCstruct | MC61755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 128 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1KVY1 | 1-125 | MSIINLGLQGVALKRSDMSSDSEKVFKNLGTIEEIRNAVLYNQTLSKEMKIAIKDTQEILQNRTTQLKLHNQKFKCIDPATHEEINN… |
| U9U6N7 | 178-320 | AMRTAPHHSWTNPAERIMSILNLGLQGVALVRDTMSPESETAFAKLDTLDEIRAAAKTNETLRSDLCKCITHVQQILEGRTEKLVLH… |
| A0A6P4Z681 | 151-284 | None |
| A0A1X7TLX5 | 2-121 | None |
| A0A1X7TYS5 | 3-124 | None |
| A0A2N0QWJ2 | 852-986 | None |
| A0A2I1EXI5 | 623-763 | None |
| A0A2Z6RBB6 | 23-143 | None |
| A0A2Z6RCT2 | 137-258 | None |
| A0A2H5SHE5 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.