DPCstruct | MC61753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0SK38 | 4-92 | EEYAEQLGEREIQPIQDLKQLSKLMIAREAFLNKLKEEGKDPIAFIGPGLVDDKPAIIVVFPDETVQIRLPATFEGYPVFIRYGVVE… |
| A0A397HSW1 | 1-85 | MSTIVPVVGDRKVYFIENDNLFDQIDDASRELMEEYLKKVPLSFTFPGMVDGKAYIIATVNLPRGTPISNLPTEFKKFPVLIDYG |
| A0A2I1F7C1 | 161-250 | None |
| A0A015LXC7 | 194-301 | None |
| U9UH91 | 3-89 | None |
| A0A2N0R512 | 85-199 | None |
| U9T395 | 269-355 | None |
| A0A2H5SN64 | 3-92 | None |
| A0A2Z6RQL8 | 109-203 | None |
| A0A015M3R1 | 3-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.