DPCstruct | MC61743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 130 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 36.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1GVT2 | 13-139 | SVSDFKELIDISLFKVFIENEVNLHTLVIEITSIYYSKRLYNILELISQNTNFIHNIRNLKLYINKRDNENMIIKVLQVVNSHQHHK… |
| A0A2N1MJD2 | 3-122 | LFKIIIENEVNLHTFEIEFIPRHFHDPYLNDFLELILQNTNFIHNIGNLNLYTIEYDNDHSLIIKNNILQIIKLHQNLKKIVLGYQN… |
| U9U3Q7 | 45-185 | None |
| U9UEI4 | 23-162 | None |
| A0A2I1GZM8 | 126-257 | None |
| U9SL03 | 61-179 | None |
| U9SKH4 | 2-130 | None |
| A0A2N0NGZ9 | 28-159 | None |
| A0A2N1MQA2 | 110-221 | None |
| A0A2N1M7L9 | 2-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.