DPCstruct | MC61742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 147 ± 16 aa |
| Standard deviation of domain lengths | 16.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1GLK9 | 5-142 | DVEQIYKAYEEINNASDNTPEIKRSYEILIAGAHGSSNCKRLAAQFIPRFFGKFPEYYETALDALFDLCEDTDINVRLTVIKYMPNV… |
| A0A287E2Q6 | 11-155 | VERLYELGDRLSSAKDKSQHAADYEAIIASVKGQNVKAKQLAAQLIPRYFRSFPALGTFAMEAMFDLVEMEELAIRIQAIRGFPLLA… |
| A2DFA2 | 15-158 | None |
| A0A498MBP6 | 1-130 | None |
| A0A1E3J0Q4 | 247-419 | None |
| S9WE23 | 80-205 | None |
| A0A178VJW9 | 2-146 | None |
| A0A178W5V8 | 9-156 | None |
| A0A0B2VZZ2 | 7-153 | None |
| A0A015LS42 | 5-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.