DPCstruct | MC61741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 142 ± 23 aa |
| Standard deviation of domain lengths | 22.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1GJD0 | 4-137 | VPKKQVTENTKPFLIFKNNNNSTYDFYNGKTSCNGSNNTFRELSHQYLFIPVKRNETLEEAYARITVESEELMEKSNGEINMKITEN… |
| A0A2Z6R4Z3 | 117-264 | KKFITYQENEVNDIVHIYNGKAIKSITVQQFQKLKFSKNYSFVPAKRQESLEKAYIRINAERDAFLQETKKLGLPIDISLLDWNIKK… |
| A0A397JXX2 | 69-246 | None |
| U9TMB3 | 1-112 | None |
| A0A2N1MZH5 | 204-352 | None |
| A0A2H5SYT5 | 111-251 | None |
| A0A2Z6R4D0 | 192-315 | None |
| A0A372QCR9 | 84-231 | None |
| A0A2H5RTV7 | 75-234 | None |
| A0A2H5UAW9 | 683-824 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.