DPCstruct | MC61736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 74 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7S5V2 | 2-78 | FALLFSLFVLFTKILAAPESKGTYLRREHSLMRPYQGKPHGFGMTIPNWDFHGSTFVSSNYIRLTPDHQSKQGSLWN |
| T1H0B7 | 2-77 | SNLIYSILFLTLSTVSSIVAELDAGQSYVSRDHSLTRPYPNVGKLWDFSGHTMITNNYVRLTPDLQSKSGAIWNTS |
| A0A0S7FLT2 | 1-85 | None |
| A0A6V7XRR5 | 42-102 | None |
| A0A7J7JAH1 | 1-79 | None |
| A0A5B7DY06 | 1-85 | None |
| A0A226N1D4 | 27-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.