DPCstruct | MC61730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 164 ± 27 aa |
| Standard deviation of domain lengths | 27.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04858 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7RMD1 | 25-159 | PVHLALLDELITCHPLQHRLVLNLLIRLFESDTPLDTLVELEFKKTVLDRMIHMLSRGYVIPVISFIHKCMTGQITDNSLIRHFVTE… |
| A0A183DZ52 | 11-143 | PTHMALLDEIVTKHPSLHTKVFELLSRLYDRQANQMRLTEVIIGRQRCIVDRFIQLLAFGFALPVIEKIYRMFREGQIDVSLVRYFV… |
| A0A803J950 | 560-695 | None |
| A0A182JQG4 | 72-224 | None |
| A0A7S3LGN9 | 210-385 | None |
| A0A1X7SP00 | 2-110 | None |
| A0A7J8DJT3 | 368-500 | None |
| J9EYT0 | 262-414 | None |
| A0A7S0N2G3 | 82-255 | None |
| A0A7I8VHE7 | 61-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.