DPCstruct | MC61729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 204 ± 39 aa |
| Standard deviation of domain lengths | 39.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0QB12 | 2-173 | AEMNVLADFLQKPLGKMGIISLLLYAFEENIDDDFICPCERVENIVTSLLYGVVPSIGSFFVSYRVMDSPDRSQYKCLYSVLTAVVW… |
| A7RJ33 | 1-200 | MSVLFGNFVTAAQSYAEKAGFHIKGGLISLIVYCGNTFMQRIVFSCPATNYALYGNLFLYAPAVVLFCLSLLVSESFWHLTTSCCHK… |
| A0A2B4S011 | 38-246 | None |
| A0A3L7I0S7 | 268-477 | None |
| A0A1S3PDK4 | 68-247 | None |
| A0A3B4E034 | 7-164 | None |
| A0A384AJN3 | 316-563 | None |
| A0A671MT20 | 4-172 | None |
| A0A5C6NLE5 | 69-211 | None |
| S9WDW7 | 1-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.