DPCstruct | MC61728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 245 ± 53 aa |
| Standard deviation of domain lengths | 52.88 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 47.53 |
| Assigned Pfam label(s) | PF15612- CL0125- PF02791- PF15613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7RH53 | 5-225 | IRSWWEVPSIAHFCSLFRTAFGLTDFEIEDLEDALLLDGSKEDSYNRFLADLHASLLKGLFTGNKDINADNFEPYLSEVLKIRWQDE… |
| A0A6A0H7Y3 | 4-131 | VSPVIVQLVLLLLRKLNRATKIDRWEKALQRFAHLHSLKDGWELERFGFKQAQLEVKIRVLKNLFEALFDSCKSFKDKINGLAAREL… |
| A0A453E8I2 | 2-194 | None |
| A0A820CZ10 | 52-311 | None |
| K3WKR2 | 2-149 | None |
| K3WZ96 | 211-514 | None |
| M1WBM7 | 10-291 | None |
| A0A1E4SCI0 | 35-379 | None |
| A0A6P5MLT3 | 21-301 | None |
| A0A287I028 | 10-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.