DPCstruct | MC61724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 211 ± 34 aa |
| Standard deviation of domain lengths | 33.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | PF02470- PF02405 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6L8P1 | 3-168 | AIVKEHLTQAGNFSLFIGRFFKEILVPPFQINEFLRQCYTIGCKSLPLVSITGFIMGLVLTIQSRPTMTKFGAESWLPSMVSLSLIR… |
| A0A0L0MG14 | 133-331 | MFGGFVLDLFGLVRRPKRIPWTEISANIYSAGAQALAITALVAFLIGIVLSYLSAQQLRMFGANQYIVNILGLSVIRELGPVLSAIL… |
| A0A5N0V9C4 | 2-228 | None |
| A0A6G3V374 | 11-195 | None |
| Q85FS1 | 2-229 | None |
| A0A7C5J1B1 | 2-163 | None |
| A0A813AIG4 | 253-480 | None |
| A0A3M1SSU8 | 751-1014 | None |
| A0A2U1RKB5 | 2-261 | None |
| A0A3N0V5T6 | 16-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.