DPCstruct | MC6172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 4 aa |
| Standard deviation of domain lengths | 4.23 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4QEH3 | 43-128 | AMTAARLGESEWAVDFLLMDRMKNAYLQNGHNYQRKGLTSYLPGNGALLLAVAMMAAGYAGHEETLFGFPKNGEWEVKMEGIHPIL |
| A0A1Q5CRB7 | 1-80 | MGRPDLAVAALLTDAGKNQYLATGHSPQIGSLLSLYLPANGALLAAVSLMAAGWDGAADCPGFPGDGTWQVRHEGFIPWP |
| B7B5B2 | 169-253 | None |
| A0A4Q3UCB0 | 110-195 | None |
| A0A4Q3W8W9 | 254-328 | None |
| A0A645G8N0 | 1-87 | None |
| A0A178B9J3 | 209-288 | None |
| A0A644WMZ4 | 84-169 | None |
| A0A2R6QIV3 | 2-79 | None |
| A0A812PJ60 | 887-974 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.