DPCstruct | MC61716
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090RJ42 | 1-69 | MTAVDRVYQKIKRSRRYVFERKDFDGFASYDQIGRALRQLVKQGELIKLGYGLYTKARMNSLTGRPMPT |
| A0A6I4M650 | 65-134 | GTIEERIERKISKSRRNVFMRENFKDFGSYDAVGRALKKKTESGRLIQISKGIYAKAEYSRITGKPAPLV |
| A0A2A2KKF2 | 88-174 | None |
| A0A812P0I7 | 8-81 | None |
| A0A1G0HDK9 | 2-71 | None |
| A0A5Q4Z887 | 46-127 | None |
| A0A3N9Q5E6 | 45-111 | None |
| C7LYR5 | 7-82 | None |
| A3T2D6 | 1-77 | None |
| A0A1S8CSC0 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.