DPCstruct | MC61714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 26 aa |
| Standard deviation of domain lengths | 25.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U4QU15 | 1-178 | MTQDHTNLSKEESITRTKRLKTNTAHARVRSDEPSRVPISSNDNKSPASSPSAEENLFEIPDWLDPKDWNDYIEYRKGIRAPMSPVA… |
| A0A808XBJ3 | 6-112 | HTEVRLGKYSIKKKEKDTSLDKIINSYTQDEELINTIRDFLKMRKAIKKPMTDRALKIMLNKLDKYADTPQKKIKILENSIENSWQG… |
| A0A0J1G8G1 | 63-173 | None |
| A0A2R3MW47 | 12-152 | None |
| A0A134AHQ9 | 1-150 | None |
| A0A377XU76 | 67-194 | None |
| A0A7D6H8N4 | 2-138 | None |
| W1U4E1 | 37-176 | None |
| A0A7X5DCJ6 | 1-164 | None |
| U5QHI3 | 121-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.