DPCstruct | MC61712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 104 ± 16 aa |
| Standard deviation of domain lengths | 15.80 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662QWJ7 | 2-74 | KRKYELFLDDIVENVDRIQRFVSGMSFDDFKDDEKTVYAVSRSLEIIGESVSQIPDEVRDKYDDIPWRDIEYL |
| Q57876 | 2-108 | RKDVKIYLNHILESIELIEEYTKDKTEDDFFTSKFLQDAVIRRIEIIGEAIKNLPMEFREKYNHIPWKEFAEMRDILIRKYFGVDLG… |
| A0A3L7YQT1 | 41-154 | None |
| F2LWS0 | 1-79 | None |
| A0A6C0GSP7 | 3-116 | None |
| A0A5C7KB34 | 25-131 | None |
| A0A327KWG8 | 126-241 | None |
| A0A450SDE9 | 42-165 | None |
| A0A7G9FFC0 | 1-109 | None |
| A0A1Q8YEV8 | 6-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.