DPCstruct | MC61711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 104 ± 11 aa |
| Standard deviation of domain lengths | 11.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XVG1 | 46-148 | LGVGFLGMGFQPKWALTDIPIMPKGRYEIMRNYMPKVGTLGLDMMFRTCTVQVNLDFSSEQDMIRKFRASLALQPIATAIFANSPFK… |
| A0A352VMF9 | 1-121 | MACVGTHPFSRWAEQDITQKERYHLLVNRCQWPARRLMIFGLHVHVGIASGEKATATFNSLSTYIPHLLALSASSPYFKGEETGLAS… |
| A0A6G3VKQ4 | 33-119 | None |
| A0A653NEX2 | 84-187 | None |
| A0A4R8UXW6 | 16-122 | None |
| A0A351SX01 | 7-118 | None |
| A0A0L0KZE9 | 89-199 | None |
| I0L7N3 | 35-129 | None |
| A0A372ZN04 | 112-225 | None |
| A0A2V2KY26 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.