DPCstruct | MC6171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 138 |
|---|---|
| Mean domain length (aa) | 340 ± 53 aa |
| Standard deviation of domain lengths | 53.26 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3GVU7 | 38-343 | RDETAHNTEPLNCTTELSPDFYGFGVRLGVYFAWLSQYFANILLPSEIASSLDTNSIFLLALLASLFRGTLVHELFQIDGLILMHLS… |
| A0A4Y7Q1X0 | 2-373 | NDAAASCVIQANPDIAGIGVRISIYVQACTALIPAILSGIEAIHSSTFSSPSLSSSGSHPRQHHRQPLLSAYTTTTINWRTIQRLTT… |
| A0A6A5TBJ4 | 105-500 | None |
| A0A6A5TL29 | 4-334 | None |
| A0A4Y7QHJ7 | 11-329 | None |
| A0A4Q2DAU4 | 3-304 | None |
| A0A3N4L7G3 | 46-415 | None |
| A0A6A5QAR1 | 1-361 | None |
| S7PTW5 | 74-366 | None |
| A0A395T2Q7 | 272-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.