DPCstruct | MC61708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 176 ± 30 aa |
| Standard deviation of domain lengths | 30.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Z0T3 | 32-176 | EHKIHEIKQLVWAALENIQPNDMAFDLPESNHINFPWKEGVEDLGKFIEGELWAHLGLKEKKVIPMFQKYTNPDTMIKPWTDEGERW… |
| A0A5C3NKL9 | 2-139 | QDEEPMEVPRDMPSWSTDDWDEGTEELAGRTVAELAGMLGLSKPQVPGMAKKEHPTSAHDAWSREGRRLAESEDAVALGLFPHQWQG… |
| A0A4Q2D4Z8 | 243-461 | None |
| A0A1Y2I8V3 | 4-170 | None |
| M2P644 | 297-541 | None |
| A0A4Y9ZQ96 | 120-281 | None |
| F8PEU1 | 311-500 | None |
| F8P3B1 | 224-390 | None |
| A0A4Q9MNA9 | 9-165 | None |
| K5UIV2 | 4-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.