DPCstruct | MC61707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 88 ± 20 aa |
| Standard deviation of domain lengths | 19.74 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L0HP38 | 2-113 | DLMSTNAKGKNVRGKKLLLYGSCLDESPEYLEKFKDYTKLAFCPEREHINMAFYKLMAMLSVAEELVVITTDGSPHCVQMHYIAEEV… |
| A0A7X7MAH9 | 10-99 | TGFHNRFLKDKVLAIACPKLDSNRESYIEKLAVMIDQTKIETLTVLVMDVPCCSGLMELVRRAREKCQRYIPVKKVIITVKGNVKSE… |
| A0A847I3V0 | 2-61 | None |
| A0A497ENM1 | 3-102 | None |
| A0A7J2JYR1 | 6-81 | None |
| A0A522V7R5 | 72-171 | None |
| A0A7X9PL18 | 6-75 | None |
| A0A0S8GT70 | 128-196 | None |
| A0A662IXN8 | 6-92 | None |
| A0A1V6FE55 | 4-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.