DPCstruct | MC6170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10650 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409YM42 | 759-865 | LDLQPLKLDVITRSMDPLKRLCQYEIPGPGVCRDKDCEDIHLSKIESLEPDDNETADYIFKQLPHDWANKHQVKSASTILQALQAVR… |
| A0A4Y7PPD5 | 1-105 | MPLKARALSGRQDVILKRLCQYEVPGGGQCRDASCEELHVWELEPSDQDTAQFLAGAWPFSEAEIIGALRQARKTQGNKGPSSLETR… |
| A0A0C2X279 | 100-210 | None |
| D6RPC5 | 117-219 | None |
| F8NZ47 | 191-319 | None |
| A0A0H2RA95 | 7-107 | None |
| A0A369JA10 | 945-1058 | None |
| A0A5C2TRH2 | 56-156 | None |
| A0A1M2VKG1 | 996-1098 | None |
| A0A137QLF4 | 736-859 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.