DPCstruct | MC617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 55.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E2S3Z8 | 6-70 | RIAYLKSEVKKRILILDGGMGTMIQSYKLSEEEYRGERFADHPHDLKGNNDLLVITQPEIIKEIY |
| A0A0N4WVF0 | 1-73 | MGQRSIVFDEIATLADQRILLIDGAMGTMIQREHLEENDFRGEVLKNHPKPLKGNNDLLSITRPDIIYKVSKL |
| A0A4E0RIX6 | 4-66 | None |
| A0A0K1NM31 | 3-65 | None |
| A0A6F9C5Z1 | 7-90 | None |
| A0A0G4HWT1 | 11-77 | None |
| A0A6I9Y4V5 | 13-93 | None |
| A0A1Y7VM88 | 1-72 | None |
| A0A6N6XCI8 | 1-74 | None |
| A0A4U9TKF4 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.