DPCstruct | MC61696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 241 ± 42 aa |
| Standard deviation of domain lengths | 41.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.80 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF13547- CL0672 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0DHS6 | 575-821 | SISAPSNIVSVSPVTSSSTIQSFFGSTTWTAPLGIVSTDVLVVGGGGGGGGAYDVAGGGGGGGGYVIESLNVSVNPETEYTITVGAG… |
| A0A7X0T2C6 | 2-209 | KVNIFSQNTTYAKPTARLLKIIVTGGGGGGGGTSAVGANQGAVGSGGGAGGTAISWHSVDELEFPILLTVGKGGSGGVGGNEPQSGQ… |
| A0A3C1GF67 | 226-477 | None |
| A0A1E4M039 | 715-1007 | None |
| A0A1I1RWR7 | 2-180 | None |
| A0A4R1YV52 | 10-270 | None |
| A0A7R7MYY1 | 407-584 | None |
| A0A7X6ZI69 | 2-209 | None |
| A0A1Z9F558 | 246-488 | None |
| A0A536S047 | 561-783 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.