DPCstruct | MC6169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 182 ± 15 aa |
| Standard deviation of domain lengths | 15.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7PKM2 | 1-189 | MTTFSTLLVVCFLPSVLSAFTQNACWPNGCVQKASNGKFCYYPYTAGTDASCSSQSAELGSVLTAHLAQGHSIAYYGPDNVFVGDVS… |
| A0A165P4H7 | 16-174 | SCTFGEFTTEACWQRNCLVKNDAGTLCLHTAYNGAIATACDDSVLSSLLAAHINSTIGLSIAYYNEHAQFLGPTIWPVPQPLPYTIY… |
| A0A4Y7TWH4 | 127-312 | None |
| A0A4Y7TFM1 | 1-165 | None |
| A0A4Y7TDT5 | 1-209 | None |
| A0A164YP34 | 18-219 | None |
| A0A4Y7S4J9 | 105-292 | None |
| A0A4Q2E0L7 | 17-192 | None |
| A0A4Y7PLB1 | 13-197 | None |
| A0A0C3FFB5 | 3-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.