DPCstruct | MC61689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7B0K6 | 10-68 | TVRTAIRNAGGVTKWARRFGITRGSIYEWIDRAEVPSDRAVIIERESFGLAKRQELRPN |
| A0A315BQB2 | 3-80 | EKNPLEQAIRSAGSINKLAMVLGVSKGAVWQWGLPGRQVPAEHCPAIERITGGMVRCEQLRPDVDWAYLRIPSQEGAA |
| A0A5E4YRX6 | 2-75 | None |
| A0A4V5NK55 | 1-67 | None |
| A0A2E2GGM7 | 3-71 | None |
| A0A2S7E1J6 | 51-125 | None |
| K1Z6T8 | 9-73 | None |
| A0A3M0X1L3 | 1-71 | None |
| A0A2S6ZLY1 | 1-73 | None |
| Q5P988 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.