DPCstruct | MC61684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 142 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V1LZB8 | 3-131 | GHPLRIGMGAWRPYEALLWPRQQAFLEAAATAMHLIETGEVPTAGGLGPLLRPTPHQPVGDGTAPVNEPVTRWKQTMDALNDAIAAA… |
| A0A4V6P4H4 | 19-149 | GHPVRAGQSMWRPFEAQTPQTQQRTLEAAAIAMDLLESGDLTGRGDAAPLFLPEPDVSITPGPPRQTHKSLEDRWQDLADALKAVIE… |
| A0A1M3M086 | 41-233 | None |
| G9EIL2 | 51-203 | None |
| A0A260LPG9 | 30-173 | None |
| A0A1H3CXN0 | 133-311 | None |
| C7T592 | 328-499 | None |
| A0A5S4FUH1 | 2-125 | None |
| A0A380Q316 | 162-264 | None |
| A0A239GVL8 | 133-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.