DPCstruct | MC61681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 166 ± 43 aa |
| Standard deviation of domain lengths | 43.03 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | CL0105- CL0597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645IB35 | 2-120 | PRVRADLGYPPLVTPTSQIVGSMATFNVMLGERYKIVPREVKDLARGKYGRTPLPVAEEVREKIIGTDPIIDYRPADDIPPQLDTLK… |
| A0A847ES91 | 10-154 | EVPLVKADAGHPPLVTPSSQIVGTQAVFNVLMGKYKVLTGEFADLMLGYYGECIGERNPEVVEVARAQTKKEPITQRPADLLEPEWD… |
| A0A368A5B3 | 2-247 | None |
| A0A1V5BLI6 | 206-346 | None |
| A0A7X8IZK1 | 70-198 | None |
| A0A7W0JKM0 | 199-328 | None |
| A0A6S7GE88 | 1-304 | None |
| A0A3N2MAC6 | 390-528 | None |
| A0A368FAW3 | 2-174 | None |
| A0A179G4W4 | 483-738 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.