DPCstruct | MC61680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 224 ± 19 aa |
| Standard deviation of domain lengths | 19.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287WUF7 | 3-205 | EIEDLQAPRSLPYALLCIKDPREYFDSQQANALRPLGSNDGRKARSCSLSTDDAFRHLMDQISSVKMNCPVVQSDVALKVLNELNEG… |
| A0A2D4NS41 | 1-213 | MDGNSRDSDIFQPPVKKVKLQESIEYEDLEHNNSIKTIALNLKKSDRYYHGPTPIQSQQYATSHDIINSFCSIREEIEGYVPKLTQV… |
| A0A0V0XIC0 | 145-361 | None |
| A0A6P5XS15 | 196-410 | None |
| A0A7J6AFD4 | 291-549 | None |
| D2UXG4 | 348-570 | None |
| A0A287MAE6 | 138-361 | None |
| A0A0L6WBM7 | 228-446 | None |
| A0A151MCJ6 | 303-554 | None |
| A0A1B6D7E9 | 108-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.