DPCstruct | MC6168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0063- CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9Y2A4 | 643-705 | DLPKRLASRKRVSPEEFTEIMEQREQFYQKVNFSPPGDKSSLFPGTWYLERVDEMYRRKYARR |
| A0A4Y7PK19 | 1-70 | MNLLERLQSMRVVPCEDYVTAMKLREANHNATSYTPAGSTDDLWPGTYYLTHIDEKYRRSYAVVPHLEMI |
| D8LEJ9 | 432-500 | None |
| A0A2G9RBR0 | 122-193 | None |
| A0A0F8VCI1 | 2-59 | None |
| A0A0F0IGG3 | 223-284 | None |
| M2PRL3 | 3-66 | None |
| G2YB32 | 9-73 | None |
| A0A2B4RPK8 | 493-563 | None |
| A0A834THJ1 | 497-572 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.