DPCstruct | MC61676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 40.75 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0466- CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287W4H9 | 2-68 | GFPILGIEWQKMENPDLRKAMGMKSDQKGVRIRRIEPTAPESGCMQPSDIILSFDGIEIANDGTGLL |
| A0A453R6U4 | 228-294 | GFPILGIEWQKMENPDLRKAMGMKSDQKGVRIRRIEPTAPESGCMQPSDIILSFDGIDIANDGTVPF |
| A0A6A2XB03 | 234-286 | None |
| R7QDZ4 | 49-127 | None |
| A0A7J6PR13 | 745-816 | None |
| A0A067GNS5 | 313-378 | None |
| A0A357IYR1 | 16-88 | None |
| A0A3N7FRT6 | 49-129 | None |
| A0A178U6G0 | 164-229 | None |
| A0A7J7L4E5 | 148-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.