DPCstruct | MC61675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 166 ± 31 aa |
| Standard deviation of domain lengths | 31.26 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02042 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287W3K2 | 1-149 | MEQSDNSTEVSGKGLPLPLPCYGEENGSASNATRADRVRSERVLTFELVSQYFYMPITQAARELNVGLTILKKRCRELGIPRWPHRK… |
| A0A150H3T5 | 1-131 | MAARARKRSVRNGVCARIASITKERLQQVYHLNIEEAARELGIGMTKLKEHCRTLGIPRWPSRKLKSMDKLIESLNERAATEPATKE… |
| A0A5N6P511 | 314-476 | None |
| A0A2G2WQY4 | 288-467 | None |
| A0A2K1IU66 | 227-388 | None |
| A0A2G3AV78 | 72-200 | None |
| A0A830CEK7 | 1-121 | None |
| C1ECA4 | 139-305 | None |
| C1EJ86 | 4-232 | None |
| A0A662X449 | 150-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.