DPCstruct | MC61674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 256 ± 42 aa |
| Standard deviation of domain lengths | 41.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 41.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VWC0 | 3-248 | VPTNLEARRRISFFTNSLFMEMPRAPRVRKMLSFSVMTPYYSEETVYSRNDLDLENEDGVSIIFYLQKIFPDEWNNFMERISCKREA… |
| A0A1D6GWW7 | 1-172 | MAQEPLLEPMLLYTILTPYYKEDVLFSLQNLEERNEDGVSILFYLQKIYPDEWKNFLERVGCKNEEVLREDEQLEEKLCLWVSYRGQ… |
| A0A445I842 | 220-393 | None |
| A0A812M2C4 | 488-823 | None |
| A0A287TSD6 | 244-509 | None |
| A0A453DH04 | 18-202 | None |
| A0A6A3UIE4 | 40-288 | None |
| A0A0L9V9W1 | 334-604 | None |
| A0A7S2JUY3 | 52-435 | None |
| A0A287PW09 | 834-1120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.