DPCstruct | MC61670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 17.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VSV0 | 1-119 | DLGRDLGLGSRFPGKRGKVRRVKRIPRSTVYRFIRKRIAARKDELRQHYNPCGCQLACGKQCPCQKNGTCCEKFCGCPEACRNRFLG… |
| R7T4Q6 | 267-387 | GQQRKKKKKTKSVWSSHFRKIQMKRDNSSNRVYNFVPCDHPGQRCDDSCACIVSQNFCEKFCLCGPDCHNRFPGCRCKAHCNTKQCP… |
| M4C1I8 | 151-279 | None |
| M2P705 | 388-515 | None |
| A0A1C1D108 | 1029-1144 | None |
| A0A4S2LRF6 | 708-852 | None |
| W2X041 | 70-201 | None |
| A0A178WGQ4 | 678-797 | None |
| A0A287VTE2 | 265-386 | None |
| A0A287VSS1 | 145-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.