DPCstruct | MC6167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 196 ± 37 aa |
| Standard deviation of domain lengths | 37.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7PH85 | 34-213 | KSARKAAKVAKEGEVWVGAWINDARARMIAASEDPEIHELVERWARLEATLGKPEVRKGYQLDAKQRPAELTAWLKKQTPDTAPPPS… |
| A0A371CJ63 | 9-170 | WPEWMRQSFDFLEAKQLGDDFMRALEWWTVIERSYNWESSGKGLSPAHRPEEVAHWLKVLRRNIAKSPVIKDEVSYAEKWWKWWAGL… |
| A0A4Y9ZSF8 | 26-207 | None |
| A0A4Y9ZPY7 | 1-162 | None |
| A0A4Y9ZPZ1 | 83-293 | None |
| A0A4Y9ZPC7 | 33-205 | None |
| A0A0C3BC35 | 2-171 | None |
| A0A0C3AFK5 | 20-190 | None |
| K5VEC8 | 152-374 | None |
| A0A146IPA5 | 98-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.